PEPTIDEBIOLOGIX-DB
Open Reference Database · v2025.1
A technical reference for research peptides.
Molecular characterization, sequence data, analytical specifications, and curated primary-literature citations for 36 research peptides — compiled for chemists, formulators, and laboratory scientists.
36Peptides
7Chemical Classes
170k+Words of Data
GH / GHRH Axis
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 01 | CJC-1295 | Modified GRF(1-29) + DAC | 3367.93 | 863288-34-0 | GHRH Analog |
| 02 | GHRP-2 | D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH₂ | 817.97 | 158861-67-7 | GH Secretagogue |
| 03 | GHRP-6 | His-D-Trp-Ala-Trp-D-Phe-Lys-NH₂ | 873.01 | 87616-84-0 | GH Secretagogue |
| 04 | Hexarelin | His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH₂ | 887.04 | 140703-51-1 | GH Secretagogue |
| 05 | Ipamorelin | Aib-His-D-2-Nal-D-Phe-Lys-NH₂ | 711.86 | 170851-70-4 | Selective GHS |
| 06 | MGF | IGF-1Ec C-terminal fragment | 2867.21 | — | Growth Factor Fragment |
| 07 | PEG-MGF | PEGylated MGF | ~2867 + PEG | — | Growth Factor (PEG) |
| 08 | Sermorelin | GHRH(1-29)-NH₂ | 3357.92 | 86168-78-7 | GHRH Analog |
| 09 | Tesamorelin | Hexenoyl-GHRH(1-44)-NH₂ | 5135.85 | 901758-09-6 | GHRH Analog |
Regenerative & Repair
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 10 | BPC-157 | Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val | 1419.53 | 137525-51-0 | Cytoprotective |
| 11 | GHK-Cu | Gly-His-Lys · Cu(II) | 402.92 | 89030-95-5 | Copper Tripeptide |
| 12 | TB-500 | Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln | 877.99 | 885340-08-9 | Tβ4 Fragment |
| 13 | Thymosin Beta-4 | Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | 4963.44 | 77591-33-4 | G-actin Sequestering |
Neuropeptides / Nootropics
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 14 | Cerebrolysin | Porcine brain hydrolysate (peptide complex) | <10 kDa | 12656-61-0 | Neurotrophic Complex |
| 15 | Dihexa | N-hexanoyl-Tyr-Ile-NH-(CH₂)₅-NH₂ | 474.64 | 1401708-83-5 | Ang IV Analog |
| 16 | DSIP | Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu | 848.81 | 62568-57-4 | Neuropeptide |
| 17 | Noopept | PhAc-Pro-Gly-OEt | 318.37 | 157115-85-0 | Dipeptide Nootropic |
| 18 | P21 | Ac-DGGLAG-NH₂ | 600.62 | — | Neurotrophic |
| 19 | Selank | Thr-Lys-Pro-Arg-Pro-Gly-Pro | 751.87 | 129954-34-3 | Anxiolytic |
| 20 | Semax | Met-Glu-His-Phe-Pro-Gly-Pro | 813.93 | 80714-61-0 | Nootropic |
Khavinson Bioregulators
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 21 | Cortagen | Ala-Glu-Asp-Pro | 457.43 | — | Cortical Bioregulator |
| 22 | Epithalon | Ala-Glu-Asp-Gly | 390.35 | 307297-39-8 | Pineal Bioregulator |
| 23 | Pinealon | Glu-Asp-Arg | 402.40 | — | Pineal Tripeptide |
| 24 | Thymalin | Thymic polypeptide complex | — | — | Thymic Bioregulator |
Immune / Antimicrobial
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 25 | KPV | Lys-Pro-Val | 342.43 | 65189-71-1 | α-MSH Tripeptide |
| 26 | LL-37 | [LL-37, 37 aa] | 4493.33 | 154947-66-7 | Cathelicidin AMP |
| 27 | Thymosin Alpha-1 | Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN | 3108.32 | 62304-98-7 | Immunomodulator |
Reproductive / Melanocortin
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 28 | Gonadorelin | pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH₂ | 1182.31 | 33515-09-2 | GnRH Decapeptide |
| 29 | Kisspeptin-10 | Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ | 1302.45 | 374675-21-5 | KISS1R Agonist |
| 30 | Melanotan-2 | Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂ | 1024.18 | 121062-08-6 | Melanocortin Agonist |
| 31 | Oxytocin | Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH₂ | 1007.19 | 50-56-6 | Nonapeptide Hormone |
| 32 | PT-141 | Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH | 1025.18 | 189691-06-3 | Melanocortin Agonist |
| 33 | Triptorelin | pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH₂ | 1311.45 | 57773-63-4 | GnRH Agonist |
| 34 | Vasopressin | Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH₂ | 1084.23 | 11000-17-2 | Nonapeptide Hormone |
Mitochondrial-Derived
| # | Compound | Sequence | MW (g/mol) | CAS | Class |
|---|
| 35 | Humanin | MAPRGFSCLLLLTSEIDLPVKRRA | 2687.20 | 330936-69-1 | MDP |
| 36 | MOTS-c | MRWQEMGYIFYPRKLR | 2173.55 | 1627580-64-6 | MDP / AMPK |
About this database
Peptide Biologix compiles publicly available physicochemical data and primary-literature citations for therapeutic peptides under active investigation. All molecular weights are reported as monoisotopic where indicated, otherwise as average molecular mass. CAS numbers reflect the most commonly cited registry entry for the free peptide unless noted otherwise. Where multiple synonyms exist, the most frequently used trade/research name is presented first. Compiled by Dr. Marius Kohler, Peptide Chemistry Group.