Peptide Biologix catalogues 36 synthetic and endogenous peptides across seven biological signaling axes. Each monograph documents primary amino acid sequences, CAS registry identifiers, reversed-phase HPLC and mass-spectrometric verification standards, receptor pharmacology, and peer-reviewed primary literature.
Oath Research — our top-graded source
Per-batch certificates from independent laboratory Freedom Diagnostics report HPLC-UV purity, LC-MS identity and net peptide content.
Peptides investigated in preclinical and translational models of angiogenesis, fibroblast migration, monomeric G-actin sequestration, and metallopeptide-regulated extracellular matrix remodeling.
Synthetic pentadecapeptide (Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val) derived from human gastric juice protein; modulates VEGFR2 internalization, FAK–paxillin adhesion signaling, and eNOS phosphorylation.
Synthetic N-acetylated heptapeptide fragment corresponding to the active actin-binding domain (Ac-LKKTETQ, residues 17–23) of Thymosin Beta-4; modulates G-actin sequestration, endothelial cell migration, and tissue remodeling.
Naturally occurring human plasma tripeptide-copper(II) coordination complex (Gly-His-Lys · Cu(II)); regulates collagen I/III synthesis, MMP/TIMP metalloproteinase balance, and broad transcriptomic remodeling.
Endogenous 43-residue N-terminally acetylated polypeptide (Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES); primary intracellular G-actin sequestering protein investigated in corneal and myocardial repair.
Truncated and stabilized growth hormone-releasing hormone (GHRH) analogs acting via Gs-coupled GHRH receptors, alongside synthetic peptidyl ghrelin mimetics targeting Gq-coupled GHS-R1a receptors and IGF-1 splice variants.
Tetrasubstituted 29-residue GHRH(1-29) analog (D-Ala2, Gln8, Ala15, Leu27) resisting dipeptidyl peptidase-IV (DPP-IV) cleavage while activating anterior pituitary GHRH receptors via Gs/cAMP signaling.
Pentapeptide growth hormone secretagogue (Aib-His-D-2-Nal-D-Phe-Lys-NH2); selective GHS-R1a agonist stimulating pulsatile somatotroph GH release without elevating ACTH, cortisol, or prolactin.
Synthetic amidated 29-amino acid N-terminal domain of human GHRH; represents the minimal full-potency sequence activating anterior pituitary GHRH receptors via cAMP/PKA signaling.
Full-length 44-residue human GHRH analog stabilized with an N-terminal trans-3-hexenoyl moiety conferring DPP-IV resistance; studied in visceral adipose tissue and hepatic lipid models.
Synthetic hexapeptide ghrelin receptor agonist (D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2); high-potency GHS-R1a probe used in diagnostic somatotroph reserve testing.
First-generation hexapeptide ghrelin mimetic activating pituitary GHS-R1a and myocardial CD36 scavenger receptors; foundational probe for studying orexigenic and somatotropic signaling.
Methylated hexapeptide secretagogue (His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2); binds both pituitary GHS-R1a and cardiovascular CD36 receptors in ischemia-reperfusion models.
24-residue C-terminal E-domain splice peptide (YQPPSTNKNTKSQRRKGSTFEERK) generated from alternative splicing of the IGF1 transcript under mechanical strain; activates quiescent muscle satellite cells.
Polyethylene glycol-conjugated derivative of the 24-residue MGF E-domain peptide; steric shielding reduces plasma protease clearance while retaining myoblast proliferation activity.
Enkephalinase-resistant heptapeptides (Pro-Gly-Pro C-terminal extensions), HGF/c-Met and CNTF mimetics, dipeptide prodrugs, and hypothalamic delta-EEG nonapeptides.
Synthetic heptapeptide analog of ACTH(4-10) devoid of steroidogenic activity; upregulates hippocampal and cortical BDNF/TrkB mRNA expression and modulates dopaminergic and serotonergic turnover.
Synthetic heptapeptide extending the endogenous immunomodulatory tetrapeptide tuftsin (Thr-Lys-Pro-Arg) with a C-terminal Pro-Gly-Pro tripeptide; modulates GABA-A allosteric binding and enkephalinase activity.
Amphiphilic nonapeptide (WAGGDASGE) originally isolated from cerebral venous blood; investigated for slow-wave delta EEG modulation and corticotropin (ACTH) stress-axis attenuation.
Enzymatically cleaved low-molecular-weight neuropeptide mixture (≤10 kDa) containing short neurotrophic fragments mimicking BDNF, GDNF, NGF, and CNTF signaling cascades.
Metabolically stabilized angiotensin IV analog; binds hepatocyte growth factor (HGF) as an allosteric dimerization stabilizer, potentiating c-Met receptor phosphorylation and dendritic spinogenesis.
Peptidomimetic proline-containing dipeptide ester absorbed via intestinal PEPT1 and biotransformed into endogenous neuropeptide cyclo-L-prolylglycine; modulates AMPA currents and HIF-1α.
Synthetic CNTF-derived neurotrophic peptide analog (Ac-DGGLAG-NH2); inhibits LIF/STAT3 signaling and GSK-3β activity to promote dentate gyrus neurogenesis and synaptic plasticity.
Anti-inflammatory melanocortin C-terminal tripeptides, amphipathic cathelicidin host-defense α-helices, and thymic Toll-like receptor immunomodulators.
C-terminal tripeptide of α-melanocyte-stimulating hormone (Lys-Pro-Val); transported intracellularly via PepT1 to inhibit IκBα degradation and NF-κB p65 nuclear translocation without pigmentary MC1R agonism.
Sole human cathelicidin-derived 37-residue cationic amphipathic α-helical peptide ([LL-37, 37 aa]); disrupts bacterial membranes via toroidal pore formation and neutralizes LPS.
28-residue N-terminally acetylated acidic polypeptide isolated from thymic fraction 5; engages dendritic cell TLR2/TLR9 (MyD88) pathways to drive CD4+/CD8+ T-cell maturation and IFN-γ secretion.
Cyclic lactam heptapeptide melanocortin receptor agonists (MC1R/MC3R/MC4R), hypothalamic GPR54 and GnRHR decapeptides, and posterior pituitary disulfide-bridged nonapeptides.
Cyclic lactam heptapeptide α-MSH analog with an Asp2–Lys7 bridge and D-Phe core; non-selective agonist across MC1R, MC3R, MC4R, and MC5R coupled to Gs/cAMP signaling.
Carboxylate C-terminal analog (-Lys-OH) of Melanotan 2; exhibits nanomolar agonist affinity at central MC4R and MC3R receptors activating hypothalamic paraventricular oxytocin-dopamine circuits.
Native hypothalamic decapeptide with an N-terminal pyroglutamyl ring; stimulates anterior pituitary gonadotroph LH and FSH synthesis when delivered in physiological pulses.
Conserved C-terminal decapeptide of the KISS1 gene product; endogenous ligand for GPR54 (KISS1R) on hypothalamic GnRH neurons driving upstream gonadotropin pulsatility.
Position-6 D-Trp substituted GnRH superagonist with increased GnRHR binding affinity and peptidase resistance; induces initial gonadotropin flare followed by receptor downregulation.
Magnocellular hypothalamic nonapeptide containing a 20-membered Cys1–Cys6 disulfide ring; activates Gq-coupled OXTR receptors in smooth muscle and central limbic social-recognition circuits.
Posterior pituitary disulfide nonapeptide differing from oxytocin at positions 3 (Phe) and 8 (Arg); activates vascular V1a, pituitary V1b, and renal collecting-duct V2 aquaporin-2 receptors.
Short tri- and tetrapeptides (Ala-Glu-Asp-Gly, Ala-Glu-Asp-Pro, Glu-Asp-Arg) and low-molecular-weight thymic polypeptide fractions investigated for chromatin remodeling, telomerase regulation, and tissue-specific gene expression.
Synthetic pineal tetrapeptide modeled on Epithalamin extract; studied in somatic fibroblast cultures for hTERT telomerase subunit induction, telomere length maintenance, and pineal melatonin synthesis.
Synthetic cerebral cortex bioregulator peptide derived from Cortexin amino acid analysis; studied in models of sciatic nerve regeneration, cortical chromatin uncoiling, and oxidative stress protection.
Synthetic CNS tripeptide (Glu-Asp-Arg); investigated in hypoxic and excitotoxic neuronal models for SOD/glutathione peroxidase upregulation, ERK1/2 modulation, and dendritic spine preservation.
Low-molecular-weight polypeptide complex extracted from mammalian thymus tissue containing short immunoregulatory peptides; studied for T-cell differentiation and thymic immune modulation.
Bioactive peptides translated from short open reading frames (sORFs) embedded within the mitochondrial 12S and 16S ribosomal RNA genes that coordinate cellular bioenergetics and retrograde nuclear stress signaling.
16-residue mitochondrial-encoded peptide (MT-RNR1); inhibits the folate-methionine cycle to accumulate endogenous AICAR, activating AMPK, skeletal muscle GLUT4 translocation, and nuclear NRF2 target genes.
24-residue mitochondrial 16S rRNA peptide; binds cytosolic Bax and IGFBP-3 intracellularly to block mitochondrial outer-membrane permeabilization while engaging extracellular CNTFR/WSX-1/gp130 receptors.
Synthetic research peptides vary in batch quality depending on solid-phase peptide synthesis (SPPS) coupling efficiency, preparative RP-HPLC fractionation, and counterion exchange. Peptide Biologix evaluates compound characterization against six analytical disclosure criteria detailed in our Vendor Analytical Comparison:
